Agentβ™₯︎Age
Catalog

BoostedTravel

Official

by LetsFG Β· Python

Flight search & booking for AI agents. 400+ airlines, $20-50 cheaper than OTAs.

com.boostedchat/travel β€” MCP Server

Flight search & booking for AI agents. 400+ airlines, $20-50 cheaper than OTAs. This MCP server enables AI agents to query airline availability and book flights through a unified API, leveraging a broad airline catalog and cost-saving capabilities.

πŸ› οΈ Key Features

  • Flight search across 400+ airlines
  • Booking integration for AI agents
  • Cost savings relative to OTAs ($20-50 typical)
  • MCP framework compatibility
  • Python SDK availability
  • Travel-domain focused tooling and readme excerpt reference

πŸš€ Use Cases

  • AI agents performing autonomous flight shopping
  • Travel planning for virtual assistants
  • Airline API integration within automation pipelines
  • Competitive fare discovery for agent workflows

⚑ Developer Benefits

  • Unified API for search and booking
  • Broad airline coverage to reduce gaps
  • Clear MCP alignment and tooling
  • Readme excerpt provides guidance and branding context

⚠️ Limitations

  • Specifics on rate limits, authentication, and error schemas are not provided in the excerpt
  • Detailed API endpoints and data models are not included here

Topics

aiai-agentsopenclawai-agentairline-apibookingflight-searchflightsmcppython-sdktravelhotel-apihotel-bookinghotelstravel-apiclinodejstypescript-sdk